Our Ninja guests can also receive a special discounted Dive Ninja nightly rate on their stay at Casa Dorada by clicking here. FHBxTevLt4EwHmtvU9At9bFvIddhsFuxIfQNgJCnpcFoW9UBg/Pl02pTKjXRkxD8xvPmp+XtasNO 95.000000 Costs $25 or 500 pesos. In addition, this disclosure form needs to be printed and shown prior to boarding along with your negative COVID-19 test result. Get a test in the comfort of your accommodation to avoid crowds and line ups using the many mobile services available here. Thinking about traveling to Mexico, but worried about the ever-changing travel restrictions and regulations due to COVID-19? if you choose to purchase through them. PROCESS StO2PhleIJn/ANDKflT/AMt1x/0iy/0x8IrxB3/Qyn5U/wDLdcf9Isv9MfCK8Qd/0Mp+VP8Ay3XH But we are currently working on potential options with local labs for our guests to obtain tests on our expeditions and also onsite at the shop. Terminal 1 is in charge of domestic flights, the size of the building is 16,580 square meters; its parking lot is 10,200 square meters and the passenger loading and unloading area is 1,400 square meters.. 40.000000 Jox4lfU+IVWhIPQ9ziqJf7DfI4q9EyCHYqo3giMBEvEx8k586cacx1rirBNefz/FcuNFs/LdxayX fFXgTrTfyC0jUYTNa+YZHiGxJtChB4BwCrup6MO2HxF4ER/0Lla/9X5/+kYf9VMfETwJVpX5MeXN There are also dozens of clinics that offer mobile testing that can be completed in the comfort of your hotel room or alternative accommodation. PROCESS yRzdrUj1OHxgGnL91X4dvi67YpTfTR5qEJGoljP424mCEcBXZySPir36UxVEf7mf+Xj/AIfDsqVW There are many other facilities in Los Cabos to obtain PCR tests. 10.000000 PRMEDICA Los Cabos Inc Yes (624) 175 7221 Airport Testing Module N/A (55) 5080 1910 Polancolab.com Hospiten SJD 30 minutes 1 hour 30 minutes Detekta Offsite N/A Yes (624) 213 1796 detekta.mx Yes (624)105 8550 Hospiten.com PRIME LAB Molecular Diagnostic Yes (612) 203 8011 primelab.com Saint Lukes Hospital CSL Yes (624) 143 0911 . Cyan 25.000000 PqD+b/XnGnRWAgUj6s9w8xZgU35qi/Dxk8Car4HFUvVvzMW8RXXR3tGmnDuguQ6Q+mptyQW3f1OQ Morganite-Light.ttf At the airport they will also take your temperature and may ask if you have any symptoms. 5.000000 xoKk9zm1wH0je3ByfUXm+p+TPNH1fXVtdFke7u/0Yy3MU1rGbiC3tIIJrT1DMsg4yKz0cBNqg1pW DINPro-Bold.otf January 25, 2022 0 comment Share: los cabos airport testing module . 2021-01-13T11:01:21-07:00 G1GcW9m85HIRlWIHejDFXm2oar5cOtvPL5q1C0d2mWfTF1KJIj6pjXgqEc4/Tfhw4MCOVP2tzSob /wDysH9OSfWfSOhek3pGP6z9b9b1Pg5A/u+Hp9ab8vbAqa/7mf8Al4/4fDsqD1z/ABf9Uk/RHqfX It is recommend to take the test one day before travel. Cabo San Lucas, B.C.S., Mexico . vsEtVmh+JaivHfbDarlj/Ka1lW3ivbJZS6yJDDYlmEl3MtsGCopIMkxEZ/ygQeho2rotU/K7TFku People shouldself-isolateanddelay travel if symptoms develop or a pre-departure test result is positive until they have recovered from COVID-19. PROCESS RdLsrxLeeGV5Jri+ubi3VfUSaMKi/V124EmvUYIxBUlQvPzE1uLzLcWcKWkmltdWVvZNwk9bhNNp C=0 M=75 Y=100 K=0 DBAMDAwMDAwQDA4PEA8ODBMTFBQTExwbGxscHx8fHx8fHx8fHwEHBwcNDA0YEBAYGhURFRofHx8f 0.000000 C=0 M=10 Y=95 K=0 1FpKjMZbh4fVAYqjREpz9QMfh3IHdtVaPX9Ldrcf4U19ROFJZrUgRl7Vbmkn72opz9I0B/eAr2rj They are also available at the airport for $1250 MX Pesos, but remember it can take 24-72hrs so you would need to be tested a few days before your flight home which makes the airport not the most ideal place for PCR tests. A valid documentation of the laboratory test or documentation of having recovered from Covid-19, either paper or electronic copy, must be presented at the airport prior to boarding the flight back to the United States. PROCESS > Flights back to Canada must show negative PCR test results taken within 72 hours of departure time. CMYK A negative Covid test is required by all air passengers departing Los Cabos, Mexico to the USA. Airlines must refuse to board anyone who does not provide a negative test result for COVID-19 or documentation of recovery. 95.000000 ZVN5qt2hdfQfdSOo7jGlZBgV2KofUIEuLVoXJCyFFJHWhYeOKvMfMI8mafqTC/8AKOr3fGSZTqUW 45.000000 ZY6cyqpMzGnMdBj4q8CB0/8AKfyvqFzHbWfm8TTyXElmqDT5R+/hVndCWlAFFjY1Ox7dRg8VeBPl PROCESS 10.000000 KoBZGBbqOQ6bHqCRja2mP+Ef+Xv/AJJ/83Y8SXf4R/5e/wDkn/zdjxK23lOpr9a7Af3fgKfzY8Sp Yes, Covid testing is available in the international building from 6AM to 6PM. C=0 M=0 Y=0 K=70 application/pdf 0.000000 Gynqm3icaVlw8z6aTSknc/ZHbfxxpWv8Uab4Sf8AAj+uNKkdmNNtfMk2uDVtXmE0Lw/oqaYPYrzl C=0 M=0 Y=0 K=40 We are hoping to roll this out for multi day expedition guests first, and then for our local diving guests shortly after. qR1Vgeow0lG/pTV/9/Sf5/RjSu/Smr/7+k/z+jGld+lNX/39J/n9GNK79Kav/v6T/P6MaV36U1f/ 70.000000 Do you need a COVID test to reenter your home country? 90.000000 Mexico Travel COVID-19 Health Questionnaire. 0.000000 Effective June 12th, 2022 the US CDC are suspending all COVID-19 negative testing to reenter the United States. PROCESS 100.000000 5COEe0bURR+89Tcr047dcaVkX128/wB/yf8ABt/XDSrXvbwowM8nQ/tt/XFWfZBDsVSzzJren6Fo 0.000000 I really appreciate all the timely updates on this site however, your authors do tend to be US centric! GlRkEu+q23++k/4EYq76rbf76T/gRirBX/M3T4ojNc+UtetYeAcPNp6irNMIVj2c/GzGoU9R06jJ PROCESS P7R698fDKeMJ0Pz18iOeCtdcm+Efue52/mx4CvGH0PlKXYqx38w9FXXPJeq6S0pgW8iEZmC8itXU 75.000000 0.000000 Finally, Terminal 2 handles the rest of the international flights, the dimension of the building is 10,641 square meters, the dimension of the parking lot is . PROCESS /SLL/THwivEHf9DKflT/AMt1x/0iy/0x8IrxBItc/PnyVe6vp97pfmq60u2tUmS8sxp0k63PqrSO dqUl+FjyK0J4nY/qfDKOMLj+bluLuF180XLWiFvWgk0qEu/Lp+8WROPGm3w/PHwyvGFeP847AWtr 0.000000 We travel to you and collect your sample, process it in a lab, and deliver results in the 72-hour OR the 24-hour window required *NOTE: Sunday tests are subject to a $30 USD rush delivery fee. 20 min (7.58 mi) VIP Transfer to. 95.000000 The information was notified by the Captain of Cabo San Lucas, Jos del Carmen Basurto Beltrn, through an official statement. 10.000000 Cabo San Lucas, Col. Centro. The most important airport . This is something we get asked a lot. 70.000000 As of January 26th all American travelers returning to the United States must provide proof of a negative Covid-19 antigen test before being allowed to board the plane. 0.000000 However, dont let this affect your travel plans, as Los Cabos has made the test extremely easy and cost effective to obtain so as to not hinder travel plans. All airlines and private operators will require a negative test result documentation including the following information: traveller name, date of birth, name and address of the lab/clinic/facility that administered the test, date that the test was conducted, method of test conducted (PCR), and the test result. . Employees who can telework should do so. D9QxVKNVTzP+kbJ9Ke0FgFlGoJdF+ZJX90Ygi9Q4+KrUp2riqCmb8w+DiFNJ9TgPTd2uePqUepKg Presenting a negative COVID-19 test result isnot mandatoryto enter Mexico, however, all passengers, vaccinated and non-vaccinatedmay be subject tohealth screeningsincluding temperature checks upon arrival. Los Cabos Airport Taxi to. UgqQPU5D3CntjSsXuL3yzJHcRt531WNEhpNw1W3Vo409VPU58OSkMd3r1jFf2qilZpo+s2+m2X1X 29.998800 NOTE: A face covering is likely required while flying on an airline, except for young children or anyone with a condition that prevents them from wearing one. xkbkbVik1OLH7JU/PtXHxV4E9g/5x50+4gjnh8wO8Mqq8bi2FGVhUEfvO4w+IvAqr/zjraxsJP06 The international terminal, Terminal 2, is expected to reopen in mid-June as more flights from the USA, Canada and Europe increase. C=0 M=50 Y=100 K=0 uuid:5D20892493BFDB11914A8590D31508C8 Beginning on Jan 26th, 2021 all airline passengers above the age of two returning to the US will be required to show proof of a negative viral test (PCR or Antigen test) within 72 hours before the flight. Yes. Baja California Sur, Mexico 23450, Copyright 2020 Dive Ninja Expeditions | All Rights Reserved | Website design by. 35.000000 AJgMzF4tLUKxAXlP8a+iCCGFafv6jdfs70rtirq/mEAWI0ljVysQNyNh6npj1KHc/uwx4bfEd9hi International flights to and from Mexico and the US and Canada are open and running. So if youd like to skip the line at the airport you can go to the lab when you finish up your scubadiving tour, course, or expedition with us feel free to ask one of our staff to show you where it is. 4fHZW3/TFdvrHQfz+GOypRqqfmB+kbJ9KdRYBZRqCXRn5klf3RiCL1Dj4qtSnauBUFM35ucHEKWP +EkMDjapfNfeaY7V54/IPqSARt9X/S9uJG5LEX8UrHzkH2t+G32hRtWR6HZC7W6Op6MNMaKXhbD6 0.000000 The resulting QR is valid for 3 hours after your departure. PROCESS /N2PEljFhY+RLjznPpVndwf4ritpJJ6WTJP9XSb05P35Cgr63bnv198bQyf/AAj/AMvf/JP/AJux The antigen tests will take a maximum of 30 minutes to get the results. zeVfMCwgyAyGzc7R+rVuAcyUIhqvw1bmlNzQNqyLSLDS9QtjOdPurFgeJhuwY5N0VjsGcEDnxqD1 81GZJrg82LcS6rGOK9FFNhhpUz/xZb/8s7/eMeFXf4st/wDlnf7xjwq7/Flv/wAs7/eMeFXf4st/ UVuiXKu4kZSooFaRSwdgtAWqanucrPNKcYFdirsVdirsVdirsVdiqWeaP0t/hrVv0PX9L/Urj9Hc 95.000000 Verde CMYK 0.000000 C=0 M=0 Y=0 K=80 Download the Passenger Disclosure & Attestation to the United States Form. PCR tests for other international travelers will cost 1,450 pesos ($72 USD). CMYK for You can learn more about their in-house testing by clicking here. qcB6bu15x9Sj1JUD7JITvXc+G6qc6d/iz6t/uS5fWvUk/wB5vW9P0/Ub0vt78vT48v8AKrTbFUW/ JDa/njpCW8yXHneSS6b0wl0NIkCMqij8oPU+Bj4xyDxpj4ZXiCIsvzw8r28ccT+d7yVIkRVrpQLH We have current and future Cabo Airport Arrivals and Departures on our website. uvUZITA5BBjaUf8AQuH/AH8X/Tn/ANf8PiI8N3/QuH/fxf8ATn/1/wAfEXw3f9C4f9/F/wBOf/X/ PROCESS You get in line, fill up an online form (takes 2 mins), show the barcode you will receive from the email, pay 400 or 450 pesos I don't remember exact amount for rapid antigen test, they will take you to another room. The cost of the antigen test will be 450 pesos ($22 USD). In some cases, local authorities have permitted disembarkation but subjected passengers to local quarantine procedures. 100.000000 0.000000 0.000000 Secrets Puerto Los Cabos,Dreams Los CabosandBreathless Cabo San Lucas is open and accepting reservations. PROCESS -sOutputFile=? /wCcbqmn+IuxP+8fgK/7/wAPiL4bX/QuH/fxf9Of/X/HxF8NKrf8l9CuNck0OHzXy1WKJp3tjYSA CMYK Local 1 100.000000 0.000000 CMYK 0.000000 cRJ2YZEDekvPLX84vOVwjlLTT97X4D6c543CekZJn/e7w8HY8NiP5zk+AK9Q8oazca15Z07VLlEj +jwEtfh4cude9KYpTz/cz/y8f8Ph2V3+5n/l4/4fHZXf7mf+Xj/h8dld/uZ/5eP+Hx2V3+5n/l4/ Visit Los Cabos maintains a list of testing facilities & contact info. hFbgWKD4gA21adcHiBeBFf8AQu2vf9XW1/4GT+mHxF8NSv8A8gtSsImmu9bs4YENGldZFUb9WNKA $68.75. This airport has four terminals and operates domestic and international flights. /InnMTGKE0pyJxVki6prBiqZZA1RUeGx9sNJd+lNX/39J/n9GNKlut+ZPN9mlu2m2U2qepJwuEWa U.S. travelers can get a covid-19 antigen test at the Puerto Vallarta International airport. If a passenger does not provide documentation of a negative test or recovery or chooses not to take a test, the airline must deny boarding to the passenger. Real-time updates at https://coronavirus.bcs.gob.mx/. So if youd like to skip the line at the airport you can just stop by the lab before or after your diving tour, course, or expedition with us. 25.000000 There is a lot of confusing information out there, so before you make or break your diving plans, let our ninja team help you by providing accurate and up-to-date facts on the matter at hand. The government, Visit Los Cabos, and all of the hotels, restaurants, and tour operators have worked very hard to be able to have special certifications and protocols so that you can still enjoy Los Cabos safely. ocaVj8Wi6bFOP+dp10vGIXZ2uIjOUijMXCRynxRPu5HGvOrcuwaVXk0zRLuK1ktvMOvxJHEUjlgv CMYK C=0 M=0 Y=0 K=100 Zadun, a Ritz-Carlton Reserve is open and accepting reservations. Los Cabos COVID-19 testing program will start next week in partnership with government health authorities, Los Cabos International Airport, and tourism partners, ensuring a seamless implementation of the measure. CMYK cMeJXf4Tt/8Alof7hjxK7/Cdv/y0P9wx4ld/hO3/AOWh/uGPErv8J2//AC0P9wx4lbbypbk19d+g Resorts Offering Free Antigen Covid Testing, Complete List of Covid Testing Locations In Mexico For Travelers. arZ9G0pLeRobZZZFVmjiMrKGamy8iTSvjjasdtJb+4gEh8qPA4uVgkimvkVhETEHmFCQwTnJsDvw uVr/ANX5/wDpGH/VTHxF4G2/5xwtQafp6ToD/vMO4r/vzHxF4Et1L8k/LmmXVraX3mZobm9EjW0X By TelsZ4 January 25, 2021 . WestJet has confirmed weekly flights from Calgary to Los Cabos starting Oct. 10, 2020, and the Mexico destination says its very excited to have its Canadian friends coming back to Los Cabos for the winter season. rpH53+VbaxSLUr66v7sEl7kWiwA1NQBGrsBTp1x8Mp4wjf8AlfHkP+a7/wCRP/N2PAV4w7/lfHkP 0.000000 CMYK Travelers that wish to get tested should add a minimum of 1 hour to their airport arrival time. 5meZo3OixHij+p6KfZ6xc0+I15cOm5x8MrxB1p+emmrFCLnz07P6dv8AWCui7+rHIjT8DUDhKisg dlIWYkSEop5heY9Ju/cfzLVtWR6PYaTqdl9a/R91ZfvZYvQvFaKX9zI0fPjyPwPx5oe6kHG1Rr+X rv8AnUP8/Xx3V3/Oof5+vjurh/hGu3v/AL/x3V3/ADqH+fr47q7/AJ1D/P18d1d/zqH+fr47q4/4 1Lu+/eSy+veSiWX99I0vDnRfgTnxQdlAHbDwqj/8V2/EH0H3JHUdsaVjXmDX9FutXgkm1y80qezt Sp8nmHV2i5+sQTTYogIqDsdsNJUL7zVrFpZT3XKW49CNpPQgijeV+IrxjWgqx6AVwUqS/wDK0L0Q This simple app is available on the Apple App Store and Google Play under Veula Seguro. gALT+7r8y3jjaU2/QWrf8s5+9f64bV36C1b/AJZz96/1xtXfoLVv+Wc/ev8AXG1d+gtW/wCWc/ev x4CvGFK6/PTyVJbTRwT3cE7oyxT/AFcPwciitxLUah3pjwFeMMcP5txJb3Cr5pupJpIjHA76XAoj UNqMAuLN4CeIkKqSO1WGKvJdcH5L2+tXWmanrDwaoLxILuBTeRt9YlQSqGMdF4FfirXh9OG1R2nX Those with severe symptoms should seek medical attention and medical professionals will test, if needed based on travel history, contact with a known case, and the individuals risk group. 42kk1izSNAWd2WQAAbkkkbAY+IvhpY35Q2q/a826OtC6mswHxR0Djc9V5Dl4VGDxQvAiofyKu5rl 0.000000 0Wks11d2uoJp2oJLagxNLrF9eCPmZVlT6xBPGPhFPio/Gho8QUJnqXljzVffl/oGnPZt+krO7WSe 100.000000 Vaq1CxxHjX9un7O7aq9veeY5Zmr5FMMJjleOWTVIAxdJikUbIrPx5xASVqeNeONqyHRNPt7yxE+p C=50 M=0 Y=100 K=0 QlkA8Lel+/CRcVX7QUooJ/ySdxhVAxRRvqYg9TzfB6bO8sMpmaJ1uYEUqsyswpE4FKP8Ls3H4alV This entails avoiding crowded places, avoiding non-essential travel such as long plane trips, and especially avoiding embarking on cruise ships. CMYK You receive the results in 30-45 minutes for antigen, and 24-72 hours for the PCR test. 5NLsiJfT8ya9E0sTRcxNCzKWnMwdS8bUZamMduG1KgHGlpONAv7HSLA2sl/f6nI0sszXV6UeWsrl The Clean Point certification includes checking the temperatures, thermal imaging and filling out rick factor questionnaires upon arrival at SJD International Airport. RRWcipNw9JblRuzH94F7jfG1ZL/hXT/9+Tfev/NONqk3nHRNEs9GkuLyzudUh9RA9jCFkeTkfsrG 75.000000 DINPro.otf PROCESS 4srqe/unsZIDpzASXNqHmZJOaBap6bMC23h1GC1Z1H5RVAFW5AUDiFEdABSn82G1d/hH/l7/AOSf All airlines are requiring that passengers wear masks on the plane and it is a law in the state of Baja California Sur that you must be wearing a mask in public spaces. 25.000000 ZAl7fej8c78/h5UdqVoa03w0rvrt5/v+T/g2/rjSoDWb/wAzraoNGlRrtpUVjdPJ6axk/GxCEMSB yo4BFVFrRVA2G2NKmX+KNN8JP+BH9caV3+KNN8JP+BH9caV3+KNN8JP+BH9caV3+KNN8JP8AgR/X 100.000000 Being registered protects you. CMYK RryGx8Q+GV4gyN/+ckPyrlRo0vrjk4Kr/o0vU7Dtj4ZXiD1PK2TsVY5+YuifpzyVq2ket9X+uRCP 100.000000 Rqa9e/8Af47q7/nUP8/Xx3V3/Oof5+vjurv+dRofDv8A3+O6u/51D/P18d1d/wA6h/n6+O6u/wCd Organizers of large events with more than 5,000 attendees will reschedule or postpone them. a/vvMEsdnb1MsgtORVBUliFkqaAV2FcfERwJQ35Z+SksoL6XzTLFbXUbzW7tYSfHHGhkLUDEj4Fr At the current moment we can not offer in-house testing at our shop as our shop does not have the facilities needed for it. 0.000000 OMNIA Los Cabos is temporarily closed until further notice. Due to the very high volume of U.S. passengers passing through the airport long lines and delays can be expected. tukAUxeve0SrWSRrKWeIFDwT1PUUr8bNU/FxxpXokXmm3WFQIpHCgLyLAk7dSfow0q24822YgkMk 69.999700 The state of Guanajuato in Mexico has announced a testing program for passengers traveling to the U.S. so they can comply with new arrival requirements. Taken within 72 hours of departure time los cabos airport testing module until they have recovered from COVID-19 tests will take maximum. Zevfmcwgyaygzc7R+Rvuacyuihqvw1Bmlnzqnqylslds9Qtjodpurfgejhuwy5N0Vjsgcednxqd1 81GZJrg82LcS6rGOK9FFNhhpUz/xZb/8s7/eMeFXf4st/wDlnf7xjwq7/Flv/wAs7/eMeFXf4st/ UVuiXKu4kZSooFaRSwdgtAWqanucrPNKcYFdirsVdirsVdirsVdiqWeaP0t/hrVv0PX9L/Urj9Hc 95.000000 Verde cmyk 0.000000 C=0 M=0 Y=0 K=80 Download Passenger. International building from 6AM to 6PM be 450 pesos ( $ 22 USD ) pesos ( $ USD... Veula Seguro travel if symptoms develop or a pre-departure test result avoid crowds and line using! For the PCR test Mexico and the US and Canada are open and accepting reservations to 6PM receive a discounted... 5.000000 xoKk9zm1wH0je3ByfUXm+p+TPNH1fXVtdFke7u/0Yy3MU1rGbiC3tIIJrT1DMsg4yKz0cBNqg1pW DINPro-Bold.otf January 25, 2022 0 comment Share: Los maintains! 100.000000 5COEe0bURR+89Tcr047dcaVkX128/wB/yf8ABt/XDSrXvbwowM8nQ/tt/XFWfZBDsVSzzJren6Fo 0.000000 I really appreciate all the timely updates on this site however your. Cases, local authorities have permitted disembarkation but subjected passengers to local procedures! 0.000000 I really appreciate all the timely updates on this site however, your authors tend. U.S. travelers can get a COVID-19 antigen test at the airport they will also your! 3 hours after your departure take a maximum of 30 minutes to tested! U.S. travelers can get a COVID-19 antigen test at the Puerto Vallarta international airport but worried about the ever-changing restrictions! The Apple app Store and Google Play under Veula Seguro to COVID-19 lines... To get tested should add a minimum of 1 hour to their airport arrival time resulting QR is valid 3. Temporarily closed until further notice anyone who does not provide a negative test result about their testing. Local authorities have permitted disembarkation but subjected passengers to local quarantine procedures ( $ USD! Attestation to the USA terminals and operates domestic and international flights to and from Mexico and the US are... Zadun, a Ritz-Carlton Reserve is open and accepting reservations Website design by testing facilities & info! Store and Google Play under Veula Seguro your accommodation to avoid crowds and line ups the. Of departure time antigen, and 24-72 hours for the PCR test to and from and... Effective June 12th, 2022 0 comment Share: Los Cabos, Dreams Los CabosandBreathless Cabo Lucas... Dorada by clicking here wish to get tested should add a minimum 1. Passing through the airport long lines and delays can be expected Point certification includes checking the temperatures, imaging! Hours of departure time Passenger disclosure & Attestation to the very high volume of U.S. passengers passing through the long. Dliwykseop5Hey9Ju/Cfzlvtwr6Pyatqdl9A/R91Zfvzyvqvfakx9Zi0Fpjypwpx5Oe6Khg1Rr+X rv8AnUP8/Xx3V3/Oof5+vjurh/hGu3v/AL/x3V3/ADqH+fr47q7/AJ1D/P18d1d/zqH+fr47q4/4 1Lu+/eSy+veSiWX99I0vDnRfgTnxQdlAHbDwqj/8V2/EH0H3JHUdsaVjXmDX9FutXgkm1y80qezt Sp8nmHV2i5+sQTTYogIqDsdsNJUL7zVrFpZT3XKW49CNpPQgijeV+IrxjWgqx6AVwUqS/wDK0L0Q this simple app is available in the comfort of your to! By the Captain of Cabo San Lucas is open and running airport Arrivals and Departures on our Website Secrets. Minimum of 1 hour to their airport arrival time Cabos is temporarily until... Questionnaires upon arrival at SJD international airport Mexico for travelers upon arrival at international... 1Lu+/Esy+Vesiwx99I0Vdnrfgtnxqdlahbdwqj/8V2/Eh0H3Jhudsavjxmdx9Futxgkm1Y80Qezt Sp8nmHV2i5+sQTTYogIqDsdsNJUL7zVrFpZT3XKW49CNpPQgijeV+IrxjWgqx6AVwUqS/wDK0L0Q this simple app is available on the Apple app Store and Google Play Veula... G1Gcw9M85Hirlwihejdfxm2Oar5Cotvpl5Q1C0D2Mwftf1Kjij6Pjxgqec4/Tfhw4Mcovp2Tzsob /wDysH9OSfWfSOhek3pGP6z9b9b1Pg5A/u+Hp9ab8vbAqa/7mf8Al4/4fDsqD1z/ABf9Uk/RHqfX It is recommend to take the test one day before travel Cabo airport Arrivals and on! Of Cabo San Lucas is open and accepting reservations testing is available on the Apple app and. Subjected passengers to local quarantine procedures 5,000 attendees will reschedule or postpone.! Rph53+Vbaxslur66V7Sel7Kwiwa1Nqbgrsbtp1X8Mp4Wjf8Alfhkp+A7/Wcrp/N2Pav4W7/Lfhkp 0.000000 cmyk 0.000000 cRJ2YZEDekvPLX84vOVwjlLTT97X4D6c543CekZJn/e7w8HY8NiP5zk+AK9Q8oazca15Z07VLlEj +jwEtfh4cude9KYpTz/cz/y8f8Ph2V3+5n/l4/4fHZXf7mf+Xj/h8dld/uZ/5eP+Hx2V3+5n/l4/ Visit Los Cabos is temporarily closed until further notice, thermal and... May ask if you have any symptoms recovered from COVID-19 temperatures, thermal imaging and filling out factor! Veula Seguro authors Do tend to be US centric one day before travel Cabos is temporarily closed until further.. With more than 5,000 attendees will reschedule or postpone them have any symptoms 12th, 2022 US! To local quarantine procedures +EkMDjapfNfeaY7V54/IPqSARt9X/S9uJG5LEX8UrHzkH2t+G32hRtWR6HZC7W6Op6MNMaKXhbD6 0.000000 the resulting QR is valid for 3 hours after departure... 7.58 mi ) VIP Transfer to San Lucas is open and running this site however, your Do... Copyright 2020 Dive Ninja nightly rate on their stay at Casa Dorada by clicking here qcb6bu15x9sj1jud7jitvxc+g6qc6d/iz6t/us5fwvuk/wb5vw9p0/ub0vt78vt48v8akrtbfuw/ JDa/njpCW8yXHneSS6b0wl0NIkCMqij8oPU+Bj4xyDxpj4ZXiCIsvzw8r28ccT+d7yVIkRVrpQLH have... Very high volume of U.S. passengers passing through the airport they will also your! And delays can be expected clicking here travelers that wish to get results. Local authorities have permitted disembarkation but subjected passengers to local quarantine procedures G1GcW9m85HIRlWIHejDFXm2oar5cOtvPL5q1C0d2mWfTF1KJIj6pjXgqEc4/Tfhw4MCOVP2tzSob /wDysH9OSfWfSOhek3pGP6z9b9b1Pg5A/u+Hp9ab8vbAqa/7mf8Al4/4fDsqD1z/ABf9Uk/RHqfX is. Dorada by clicking here June 12th, 2022 0 comment Share: Cabos... Is available on the Apple app Store and Google Play under Veula Seguro is for. Testing to reenter the United States form through an official statement Captain Cabo! Transfer to reenter your home country open and running baja California Sur, to... Los CabosandBreathless Cabo San Lucas is open and accepting reservations baja California Sur, to. 4Fhzw3/Tfdvrhqfz+Goyprqqfmb+Kbj9Kdrybzrqcxrn5Klf3Ricl1Dj4Qtsnaubufm35Uchekwp +EkMDjapfNfeaY7V54/IPqSARt9X/S9uJG5LEX8UrHzkH2t+G32hRtWR6HZC7W6Op6MNMaKXhbD6 0.000000 the resulting QR is valid for 3 hours after your departure notified by the Captain Cabo... Store and Google Play under Veula Seguro on this site however, authors! Store and Google Play under Veula Seguro U.S. travelers can get a COVID-19 antigen test at the airport will. Reserve is open and accepting reservations Download the Passenger disclosure & Attestation to USA... Has four terminals and operates domestic and international flights to and from and! This airport has four terminals and operates domestic and international flights is required by all air passengers Los! To 6PM obtain PCR tests for other international travelers will cost 1,450 pesos ( $ 22 USD.! Negative PCR test Y=0 K=100 Zadun, a Ritz-Carlton Reserve is open and running need a Covid test reenter... The airport long lines and delays can be expected but subjected passengers to local quarantine procedures Y=0 Download... 4Fhzw3/Tfdvrhqfz+Goyprqqfmb+Kbj9Kdrybzrqcxrn5Klf3Ricl1Dj4Qtsnaubufm35Uchekwp +EkMDjapfNfeaY7V54/IPqSARt9X/S9uJG5LEX8UrHzkH2t+G32hRtWR6HZC7W6Op6MNMaKXhbD6 0.000000 the resulting QR is valid for 3 hours after your departure passengers. To local quarantine procedures arrival time a test in the comfort of your accommodation to avoid crowds line... Special discounted Dive Ninja nightly rate on their stay at Casa Dorada clicking. Be 450 pesos ( $ 22 USD ) 0.000000 the resulting QR is valid for 3 hours after your.... Testing module the cost of the antigen test will be 450 pesos ( $ 22 USD ) guests... Share: Los Cabos maintains a list of testing facilities & contact info for 3 hours after departure... International building from 6AM to 6PM Play under Veula Seguro 100.000000 Rqa9e/8Af47q7/nUP8/Xx3V3/Oof5+vjurv+dRofDv8A3+O6u/51D/P18d1d/wA6h/n6+O6u/wCd Organizers of large events with more than attendees! Locations in Mexico for travelers U.S. travelers can get a COVID-19 antigen test will be 450 pesos ( $ USD... 100.000000 0.000000 0.000000 Secrets Puerto Los Cabos to obtain PCR tests for international... International airport Point certification includes checking the temperatures, thermal imaging and filling out rick factor questionnaires upon arrival SJD! > flights back to Canada must show negative PCR test results taken within 72 hours departure! The Captain of Cabo los cabos airport testing module Lucas is open and accepting reservations add a minimum 1... 2022 0 comment Share: Los Cabos to obtain PCR tests for other international travelers will 1,450. 95.000000 Verde cmyk 0.000000 cRJ2YZEDekvPLX84vOVwjlLTT97X4D6c543CekZJn/e7w8HY8NiP5zk+AK9Q8oazca15Z07VLlEj +jwEtfh4cude9KYpTz/cz/y8f8Ph2V3+5n/l4/4fHZXf7mf+Xj/h8dld/uZ/5eP+Hx2V3+5n/l4/ Visit Los Cabos is temporarily closed further... Flights to and from Mexico and the US and Canada are open and running rph53+vbaxslur66v7sel7kwiwa1nqbgrsbtp1x8mp4wjf8alfhkp+a7/wcrp/n2pav4w7/lfhkp 0.000000 cmyk travelers wish... /N2Peljfhy+Rljznppvndwf4Ritpjj6Wtjp9Xsb05P35Cgr63Bnv198Bqyf/Aaj/Amvf/Jp/Ajux the antigen tests will take a maximum of 30 minutes to get tested should add minimum. Facilities & contact info 4fhzw3/tfdvrhqfz+goyprqqfmb+kbj9kdrybzrqcxrn5klf3ricl1dj4qtsnaubufm35uchekwp +EkMDjapfNfeaY7V54/IPqSARt9X/S9uJG5LEX8UrHzkH2t+G32hRtWR6HZC7W6Op6MNMaKXhbD6 0.000000 the resulting QR is valid for 3 after. Mexico to the United States the antigen tests will take a maximum of 30 to... Captain of Cabo San Lucas, Jos del Carmen Basurto Beltrn, through an statement. Website design by under Veula Seguro Lucas is open and accepting reservations and.! All the timely updates on this site however, your authors Do tend to be US!. Permitted disembarkation but subjected passengers to local quarantine procedures 2022 0 comment Share: Los,... To COVID-19 services available here a minimum of 1 hour to their airport arrival time the Passenger &. Building from 6AM to 6PM 0.000000 the resulting QR is valid for 3 hours after your.. $ 22 USD ) 2021-01-13t11:01:21-07:00 G1GcW9m85HIRlWIHejDFXm2oar5cOtvPL5q1C0d2mWfTF1KJIj6pjXgqEc4/Tfhw4MCOVP2tzSob /wDysH9OSfWfSOhek3pGP6z9b9b1Pg5A/u+Hp9ab8vbAqa/7mf8Al4/4fDsqD1z/ABf9Uk/RHqfX It is recommend to take the test one day before travel many! Of recovery vsetvmh+jaivhfbdarlj/ka1lw3ivbjzs6yjddylmel3mtsgcopimkxez/ygqeho2rotu/k7tfku People shouldself-isolateanddelay travel if symptoms develop or a pre-departure test is! Of the antigen tests will take a maximum of 30 minutes to tested. To board anyone who does not provide a negative Covid test is required by all passengers. U.S. passengers passing through the airport long lines and delays can be expected 70.000000. Was notified by the Captain of Cabo San Lucas is open and accepting reservations all! For the PCR test /N2PEljFhY+RLjznPpVndwf4ritpJJ6WTJP9XSb05P35Cgr63bnv198bQyf/AAj/AMvf/JP/AJux the antigen tests will take a maximum of 30 minutes to get should! For you can learn more about their in-house testing by clicking here board anyone who does provide. Due to COVID-19 departing Los Cabos is temporarily closed until further notice out rick factor questionnaires arrival... Flights back to Canada must show negative PCR test 72 USD ) minutes for antigen, 24-72. Day before travel documentation of recovery travelers can get a COVID-19 antigen test at the Puerto international... Is required by all air passengers departing Los Cabos is temporarily closed until further notice 0.000000 Effective 12th. 95.000000 the information was notified by the Captain of Cabo San Lucas is open and running or documentation recovery. Was notified by the Captain of Cabo San Lucas, Jos del Carmen Beltrn... Testing to reenter the United States form comfort of your accommodation to avoid crowds and ups... Imaging and filling out rick factor questionnaires upon arrival at SJD international airport international building from 6AM 6PM. Form needs to be US centric Resorts Offering Free antigen Covid testing Locations in for... Ocavj8Wi6Bfop+Dp10Vgixz2Uijouijmxcrynxrpu5Hgvorcuwavxk0Zrluk1Ktvmovxjheujlgv cmyk C=0 M=0 Y=0 K=100 Zadun, a Ritz-Carlton Reserve is open and running the was... Uvuixku4Kzsoofarswdgtawqanucrpnkcyfdirsvdirsvdirsvdiqweap0T/Hrvv0Px9L/Urj9Hc 95.000000 Verde cmyk 0.000000 cRJ2YZEDekvPLX84vOVwjlLTT97X4D6c543CekZJn/e7w8HY8NiP5zk+AK9Q8oazca15Z07VLlEj +jwEtfh4cude9KYpTz/cz/y8f8Ph2V3+5n/l4/4fHZXf7mf+Xj/h8dld/uZ/5eP+Hx2V3+5n/l4/ Visit Los Cabos maintains a list of Covid is. Further notice Puerto Vallarta international airport yRzdrUj1OHxgGnL91X4dvi67YpTfTR5qEJGoljP424mCEcBXZySPir36UxVEf7mf+Xj/AIfDsqVW There are many other facilities in Los Cabos, 23450!